SPOP purified MaxPab mouse polyclonal antibody (B01P)
  • SPOP purified MaxPab mouse polyclonal antibody (B01P)

SPOP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008405-B01P
SPOP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SPOP protein.
Información adicional
Size 50 ug
Gene Name SPOP
Gene Alias TEF2
Gene Description speckle-type POZ protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SPOP (NP_001007227.1, 1 a.a. ~ 374 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8405

Enviar uma mensagem


SPOP purified MaxPab mouse polyclonal antibody (B01P)

SPOP purified MaxPab mouse polyclonal antibody (B01P)