PIP5K1A purified MaxPab rabbit polyclonal antibody (D01P)
  • PIP5K1A purified MaxPab rabbit polyclonal antibody (D01P)

PIP5K1A purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008394-D01P
PIP5K1A purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PIP5K1A protein.
Información adicional
Size 100 ug
Gene Name PIP5K1A
Gene Alias -
Gene Description phosphatidylinositol-4-phosphate 5-kinase, type I, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MASASSGPSSSVGFSSFDPAVPSCTLSSASGIKRPMASEVPYASGMPIKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PIP5K1A (AAH07833.1, 1 a.a. ~ 500 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8394

Enviar uma mensagem


PIP5K1A purified MaxPab rabbit polyclonal antibody (D01P)

PIP5K1A purified MaxPab rabbit polyclonal antibody (D01P)