PIP5K1A polyclonal antibody (A01)
  • PIP5K1A polyclonal antibody (A01)

PIP5K1A polyclonal antibody (A01)

Ref: AB-H00008394-A01
PIP5K1A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PIP5K1A.
Información adicional
Size 50 uL
Gene Name PIP5K1A
Gene Alias -
Gene Description phosphatidylinositol-4-phosphate 5-kinase, type I, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIP5K1A (NP_003548, 258 a.a. ~ 347 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8394

Enviar uma mensagem


PIP5K1A polyclonal antibody (A01)

PIP5K1A polyclonal antibody (A01)