HYAL3 MaxPab rabbit polyclonal antibody (D01)
  • HYAL3 MaxPab rabbit polyclonal antibody (D01)

HYAL3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00008372-D01
HYAL3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HYAL3 protein.
Información adicional
Size 100 uL
Gene Name HYAL3
Gene Alias LUCA-3|LUCA14|LUCA3|Minna14
Gene Description hyaluronoglucosaminidase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNSLGIIANRGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HYAL3 (AAH05896.1, 1 a.a. ~ 417 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 8372

Enviar uma mensagem


HYAL3 MaxPab rabbit polyclonal antibody (D01)

HYAL3 MaxPab rabbit polyclonal antibody (D01)