HYAL3 purified MaxPab mouse polyclonal antibody (B01P)
  • HYAL3 purified MaxPab mouse polyclonal antibody (B01P)

HYAL3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008372-B01P
HYAL3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HYAL3 protein.
Información adicional
Size 50 ug
Gene Name HYAL3
Gene Alias LUCA-3|LUCA14|LUCA3|Minna14
Gene Description hyaluronoglucosaminidase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNSLGIIANRGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HYAL3 (AAH05896.1, 1 a.a. ~ 417 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8372

Enviar uma mensagem


HYAL3 purified MaxPab mouse polyclonal antibody (B01P)

HYAL3 purified MaxPab mouse polyclonal antibody (B01P)