HIST1H3H polyclonal antibody (A01)
  • HIST1H3H polyclonal antibody (A01)

HIST1H3H polyclonal antibody (A01)

Ref: AB-H00008357-A01
HIST1H3H polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant HIST1H3H.
Información adicional
Size 50 uL
Gene Name HIST1H3H
Gene Alias FLJ92264|H3/k|H3F1K|H3FK
Gene Description histone cluster 1, H3h
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRENRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIST1H3H (AAH07518, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8357

Enviar uma mensagem


HIST1H3H polyclonal antibody (A01)

HIST1H3H polyclonal antibody (A01)