HIST1H3E polyclonal antibody (A02)
  • HIST1H3E polyclonal antibody (A02)

HIST1H3E polyclonal antibody (A02)

Ref: AB-H00008353-A02
HIST1H3E polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HIST1H3E.
Información adicional
Size 50 uL
Gene Name HIST1H3E
Gene Alias H3.1|H3/d|H3FD
Gene Description histone cluster 1, H3e
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIST1H3E (NP_003523, 69 a.a. ~ 125 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8353

Enviar uma mensagem


HIST1H3E polyclonal antibody (A02)

HIST1H3E polyclonal antibody (A02)