HIST2H2BE monoclonal antibody (M06), clone 4G6
  • HIST2H2BE monoclonal antibody (M06), clone 4G6

HIST2H2BE monoclonal antibody (M06), clone 4G6

Ref: AB-H00008349-M06
HIST2H2BE monoclonal antibody (M06), clone 4G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HIST2H2BE.
Información adicional
Size 100 ug
Gene Name HIST2H2BE
Gene Alias GL105|H2B|H2B.1|H2B/q|H2BFQ|MGC119802|MGC119804|MGC129733|MGC129734
Gene Description histone cluster 2, H2be
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIST2H2BE (NP_003519.1, 36 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8349
Clone Number 4G6
Iso type IgG2b Kappa

Enviar uma mensagem


HIST2H2BE monoclonal antibody (M06), clone 4G6

HIST2H2BE monoclonal antibody (M06), clone 4G6