EOMES monoclonal antibody (M13), clone 1A7
  • EOMES monoclonal antibody (M13), clone 1A7

EOMES monoclonal antibody (M13), clone 1A7

Ref: AB-H00008320-M13
EOMES monoclonal antibody (M13), clone 1A7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant EOMES.
Información adicional
Size 100 ug
Gene Name EOMES
Gene Alias TBR2
Gene Description eomesodermin homolog (Xenopus laevis)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq SHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EOMES (NP_005433.2, 461 a.a. ~ 569 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8320
Clone Number 1A7
Iso type IgG2b Kappa

Enviar uma mensagem


EOMES monoclonal antibody (M13), clone 1A7

EOMES monoclonal antibody (M13), clone 1A7