CDC45L monoclonal antibody (M02), clone 4C2
  • CDC45L monoclonal antibody (M02), clone 4C2

CDC45L monoclonal antibody (M02), clone 4C2

Ref: AB-H00008318-M02
CDC45L monoclonal antibody (M02), clone 4C2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDC45L.
Información adicional
Size 100 ug
Gene Name CDC45L
Gene Alias CDC45|CDC45L2|PORC-PI-1
Gene Description CDC45 cell division cycle 45-like (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FVCSTKNRRCKLLPLVMAAPLSMEHGTVTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAEDRSKFLDALISLLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC45L (NP_003495, 477 a.a. ~ 566 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8318
Clone Number 4C2
Iso type IgG2a Kappa

Enviar uma mensagem


CDC45L monoclonal antibody (M02), clone 4C2

CDC45L monoclonal antibody (M02), clone 4C2