CDC45L polyclonal antibody (A01)
  • CDC45L polyclonal antibody (A01)

CDC45L polyclonal antibody (A01)

Ref: AB-H00008318-A01
CDC45L polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CDC45L.
Información adicional
Size 50 uL
Gene Name CDC45L
Gene Alias CDC45|CDC45L2|PORC-PI-1
Gene Description CDC45 cell division cycle 45-like (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAFLEHKEQFHYFILINCGANVDLLDILQPDEDTIFFVCDTHRPVNVVNVYNDTQIKLLIKQDDDLEVPAYEDIFRDEEEDEEHSGNDSDGSEPSEKRTRLEEEIVEQTMRRRQRREWEARRRDILFDYEQYEYHGTSSAMVMFELAWMLSKDLNDMLWWAIVGLTDQWVQDKITQMKYVTDVGVLQRHVSRHNHR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC45L (AAH06232, 1 a.a. ~ 566 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8318

Enviar uma mensagem


CDC45L polyclonal antibody (A01)

CDC45L polyclonal antibody (A01)