UBL4A purified MaxPab rabbit polyclonal antibody (D01P)
  • UBL4A purified MaxPab rabbit polyclonal antibody (D01P)

UBL4A purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008266-D01P
UBL4A purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human UBL4A protein.
Información adicional
Size 100 ug
Gene Name UBL4A
Gene Alias DX254E|DXS254E|G6PD|GDX|UBL4
Gene Description ubiquitin-like 4A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UBL4A (NP_055050.1, 1 a.a. ~ 157 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8266

Enviar uma mensagem


UBL4A purified MaxPab rabbit polyclonal antibody (D01P)

UBL4A purified MaxPab rabbit polyclonal antibody (D01P)