ARD1A purified MaxPab rabbit polyclonal antibody (D01P)
  • ARD1A purified MaxPab rabbit polyclonal antibody (D01P)

ARD1A purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008260-D01P
ARD1A purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ARD1A protein.
Información adicional
Size 100 ug
Gene Name ARD1A
Gene Alias ARD1|DXS707|MGC71248|TE2
Gene Description ARD1 homolog A, N-acetyltransferase (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARD1A (NP_003482.1, 1 a.a. ~ 235 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8260

Enviar uma mensagem


ARD1A purified MaxPab rabbit polyclonal antibody (D01P)

ARD1A purified MaxPab rabbit polyclonal antibody (D01P)