SMC1L1 monoclonal antibody (M01), clone 1B9
  • SMC1L1 monoclonal antibody (M01), clone 1B9

SMC1L1 monoclonal antibody (M01), clone 1B9

Ref: AB-H00008243-M01
SMC1L1 monoclonal antibody (M01), clone 1B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SMC1L1.
Información adicional
Size 100 ug
Gene Name SMC1A
Gene Alias CDLS2|DKFZp686L19178|DXS423E|KIAA0178|MGC138332|SB1.8|SMC1|SMC1L1|SMC1alpha|SMCB
Gene Description structural maintenance of chromosomes 1A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq TLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMC1L1 (NP_006297, 366 a.a. ~ 465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8243
Clone Number 1B9
Iso type IgG1 Kappa

Enviar uma mensagem


SMC1L1 monoclonal antibody (M01), clone 1B9

SMC1L1 monoclonal antibody (M01), clone 1B9