RBM10 monoclonal antibody (M03), clone 2F12
  • RBM10 monoclonal antibody (M03), clone 2F12

RBM10 monoclonal antibody (M03), clone 2F12

Ref: AB-H00008241-M03
RBM10 monoclonal antibody (M03), clone 2F12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RBM10.
Información adicional
Size 100 ug
Gene Name RBM10
Gene Alias DXS8237E|GPATC9|GPATCH9|KIAA0122|MGC1132|MGC997|ZRANB5
Gene Description RNA binding motif protein 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QKVSMHYSDPKPKINEDWLCNKCGVQNFKRREKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILRNL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBM10 (NP_690595.1, 123 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8241
Clone Number 2F12
Iso type IgG1 Kappa

Enviar uma mensagem


RBM10 monoclonal antibody (M03), clone 2F12

RBM10 monoclonal antibody (M03), clone 2F12