USP11 monoclonal antibody (M01), clone 8G5
  • USP11 monoclonal antibody (M01), clone 8G5

USP11 monoclonal antibody (M01), clone 8G5

Ref: AB-H00008237-M01
USP11 monoclonal antibody (M01), clone 8G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant USP11.
Información adicional
Size 100 ug
Gene Name USP11
Gene Alias UHX1
Gene Description ubiquitin specific peptidase 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP11 (NP_004642, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8237
Clone Number 8G5
Iso type IgG2a Kappa

Enviar uma mensagem


USP11 monoclonal antibody (M01), clone 8G5

USP11 monoclonal antibody (M01), clone 8G5