C21orf33 monoclonal antibody (M01), clone 1F5
  • C21orf33 monoclonal antibody (M01), clone 1F5

C21orf33 monoclonal antibody (M01), clone 1F5

Ref: AB-H00008209-M01
C21orf33 monoclonal antibody (M01), clone 1F5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C21orf33.
Información adicional
Size 100 ug
Gene Name C21orf33
Gene Alias D21S2048E|ES1|GT335|HES1|KNP-I|KNPH|KNPI
Gene Description chromosome 21 open reading frame 33
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq RGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C21orf33 (NP_004640, 188 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8209
Clone Number 1F5
Iso type IgG1 Kappa

Enviar uma mensagem


C21orf33 monoclonal antibody (M01), clone 1F5

C21orf33 monoclonal antibody (M01), clone 1F5