CLPP polyclonal antibody (A01)
  • CLPP polyclonal antibody (A01)

CLPP polyclonal antibody (A01)

Ref: AB-H00008192-A01
CLPP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CLPP.
Información adicional
Size 50 uL
Gene Name CLPP
Gene Alias -
Gene Description ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLPP (NP_006003, 178 a.a. ~ 277 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8192

Enviar uma mensagem


CLPP polyclonal antibody (A01)

CLPP polyclonal antibody (A01)