MIA monoclonal antibody (M02), clone 3A6
  • MIA monoclonal antibody (M02), clone 3A6

MIA monoclonal antibody (M02), clone 3A6

Ref: AB-H00008190-M02
MIA monoclonal antibody (M02), clone 3A6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant MIA.
Información adicional
Size 100 ug
Gene Name MIA
Gene Alias CD-RAP
Gene Description melanoma inhibitory activity
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MIA (AAH05910, 1 a.a. ~ 131 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8190
Clone Number 3A6
Iso type IgG2a Kappa

Enviar uma mensagem


MIA monoclonal antibody (M02), clone 3A6

MIA monoclonal antibody (M02), clone 3A6