SLC14A2 monoclonal antibody (M01), clone 3E7
  • SLC14A2 monoclonal antibody (M01), clone 3E7

SLC14A2 monoclonal antibody (M01), clone 3E7

Ref: AB-H00008170-M01
SLC14A2 monoclonal antibody (M01), clone 3E7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC14A2.
Información adicional
Size 100 ug
Gene Name SLC14A2
Gene Alias FLJ16167|HUT2|MGC119566|MGC119567|UT-A2|UT2|UTA|UTR|hUT-A6
Gene Description solute carrier family 14 (urea transporter), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq ALPLLEMPEEKDLRSSNEDSHIVKIEKLNERSKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC14A2 (NP_009094, 40 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8170
Clone Number 3E7
Iso type IgG2a Kappa

Enviar uma mensagem


SLC14A2 monoclonal antibody (M01), clone 3E7

SLC14A2 monoclonal antibody (M01), clone 3E7