COIL MaxPab rabbit polyclonal antibody (D01)
  • COIL MaxPab rabbit polyclonal antibody (D01)

COIL MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00008161-D01
COIL MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human COIL protein.
Información adicional
Size 100 uL
Gene Name COIL
Gene Alias CLN80|p80-coilin
Gene Description coilin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDCKYSKKHWKSRENNNNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKDWANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen COIL (NP_004636.1, 1 a.a. ~ 576 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 8161

Enviar uma mensagem


COIL MaxPab rabbit polyclonal antibody (D01)

COIL MaxPab rabbit polyclonal antibody (D01)