RND2 polyclonal antibody (A01)
  • RND2 polyclonal antibody (A01)

RND2 polyclonal antibody (A01)

Ref: AB-H00008153-A01
RND2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant RND2.
Información adicional
Size 50 uL
Gene Name RND2
Gene Alias ARHN|RHO7|RhoN
Gene Description Rho family GTPase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MWDTSGSSYYDNVRPLAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDRGNEGEIHKDRAKSCNLM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RND2 (AAH18096, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8153

Enviar uma mensagem


RND2 polyclonal antibody (A01)

RND2 polyclonal antibody (A01)