ANP32A polyclonal antibody (A01)
  • ANP32A polyclonal antibody (A01)

ANP32A polyclonal antibody (A01)

Ref: AB-H00008125-A01
ANP32A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant ANP32A.
Información adicional
Size 50 uL
Gene Name ANP32A
Gene Alias C15orf1|I1PP2A|LANP|MAPM|MGC119787|MGC150373|PHAP1|PHAPI|PP32
Gene Description acidic (leucine-rich) nuclear phosphoprotein 32 family, member A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ANP32A (AAH07200, 1 a.a. ~ 249 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8125

Enviar uma mensagem


ANP32A polyclonal antibody (A01)

ANP32A polyclonal antibody (A01)