CDK2AP1 purified MaxPab mouse polyclonal antibody (B02P)
  • CDK2AP1 purified MaxPab mouse polyclonal antibody (B02P)

CDK2AP1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00008099-B02P
CDK2AP1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CDK2AP1 protein.
Información adicional
Size 50 ug
Gene Name CDK2AP1
Gene Alias DOC1|DORC1|ST19|doc-1|p12DOC-1
Gene Description cyclin-dependent kinase 2 associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDK2AP1 (AAH34717.1, 1 a.a. ~ 115 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8099

Enviar uma mensagem


CDK2AP1 purified MaxPab mouse polyclonal antibody (B02P)

CDK2AP1 purified MaxPab mouse polyclonal antibody (B02P)