SSPN MaxPab rabbit polyclonal antibody (D01)
  • SSPN MaxPab rabbit polyclonal antibody (D01)

SSPN MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00008082-D01
SSPN MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SSPN protein.
Información adicional
Size 100 uL
Gene Name SSPN
Gene Alias DAGA5|KRAG|NSPN|SPN1|SPN2|nanospan
Gene Description sarcospan (Kras oncogene-associated gene)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWKHRYQVFYVGVRICSLTASEGPQQKI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SSPN (NP_005077.2, 1 a.a. ~ 243 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 8082

Enviar uma mensagem


SSPN MaxPab rabbit polyclonal antibody (D01)

SSPN MaxPab rabbit polyclonal antibody (D01)