SSPN purified MaxPab mouse polyclonal antibody (B02P)
  • SSPN purified MaxPab mouse polyclonal antibody (B02P)

SSPN purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00008082-B02P
SSPN purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SSPN protein.
Información adicional
Size 50 ug
Gene Name SSPN
Gene Alias DAGA5|KRAG|NSPN|SPN1|SPN2|nanospan
Gene Description sarcospan (Kras oncogene-associated gene)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWKHRYQVFYVGVRICSLTASEGPQQKI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SSPN (NP_005077.2, 1 a.a. ~ 243 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8082

Enviar uma mensagem


SSPN purified MaxPab mouse polyclonal antibody (B02P)

SSPN purified MaxPab mouse polyclonal antibody (B02P)