USP5 polyclonal antibody (A01)
  • USP5 polyclonal antibody (A01)

USP5 polyclonal antibody (A01)

Ref: AB-H00008078-A01
USP5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant USP5.
Información adicional
Size 50 uL
Gene Name USP5
Gene Alias ISOT
Gene Description ubiquitin specific peptidase 5 (isopeptidase T)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDVKIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP5 (NP_003472, 71 a.a. ~ 180 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8078

Enviar uma mensagem


USP5 polyclonal antibody (A01)

USP5 polyclonal antibody (A01)