MFAP5 purified MaxPab mouse polyclonal antibody (B01P)
  • MFAP5 purified MaxPab mouse polyclonal antibody (B01P)

MFAP5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008076-B01P
MFAP5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MFAP5 protein.
Información adicional
Size 50 ug
Gene Name MFAP5
Gene Alias MAGP2|MP25
Gene Description microfibrillar associated protein 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MFAP5 (NP_003471.1, 1 a.a. ~ 173 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8076

Enviar uma mensagem


MFAP5 purified MaxPab mouse polyclonal antibody (B01P)

MFAP5 purified MaxPab mouse polyclonal antibody (B01P)