MFAP5 polyclonal antibody (A01)
  • MFAP5 polyclonal antibody (A01)

MFAP5 polyclonal antibody (A01)

Ref: AB-H00008076-A01
MFAP5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MFAP5.
Información adicional
Size 50 uL
Gene Name MFAP5
Gene Alias MAGP2|MP25
Gene Description microfibrillar associated protein 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MFAP5 (NP_003471, 71 a.a. ~ 173 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8076

Enviar uma mensagem


MFAP5 polyclonal antibody (A01)

MFAP5 polyclonal antibody (A01)