PTP4A2 monoclonal antibody (M07), clone 3C2
  • PTP4A2 monoclonal antibody (M07), clone 3C2

PTP4A2 monoclonal antibody (M07), clone 3C2

Ref: AB-H00008073-M07
PTP4A2 monoclonal antibody (M07), clone 3C2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PTP4A2.
Información adicional
Size 100 ug
Gene Name PTP4A2
Gene Alias HH13|HH7-2|HU-PP-1|OV-1|PRL-2|PRL2|PTP4A|PTPCAAX2|ptp-IV1a|ptp-IV1b
Gene Description protein tyrosine phosphatase type IVA, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTP4A2 (NP_003470.1, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8073
Clone Number 3C2
Iso type IgG1 Kappa

Enviar uma mensagem


PTP4A2 monoclonal antibody (M07), clone 3C2

PTP4A2 monoclonal antibody (M07), clone 3C2