CUL5 polyclonal antibody (A01)
  • CUL5 polyclonal antibody (A01)

CUL5 polyclonal antibody (A01)

Ref: AB-H00008065-A01
CUL5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CUL5.
Información adicional
Size 50 uL
Gene Name CUL5
Gene Alias VACM-1|VACM1
Gene Description cullin 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CUL5 (AAH63306, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8065

Enviar uma mensagem


CUL5 polyclonal antibody (A01)

CUL5 polyclonal antibody (A01)