FOSL1 purified MaxPab rabbit polyclonal antibody (D01P)
  • FOSL1 purified MaxPab rabbit polyclonal antibody (D01P)

FOSL1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008061-D01P
FOSL1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FOSL1 protein.
Información adicional
Size 100 ug
Gene Name FOSL1
Gene Alias FRA|FRA1|fra-1
Gene Description FOS-like antigen 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FOSL1 (NP_005429.1, 1 a.a. ~ 271 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8061

Enviar uma mensagem


FOSL1 purified MaxPab rabbit polyclonal antibody (D01P)

FOSL1 purified MaxPab rabbit polyclonal antibody (D01P)