PDHX purified MaxPab rabbit polyclonal antibody (D01P)
  • PDHX purified MaxPab rabbit polyclonal antibody (D01P)

PDHX purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008050-D01P
PDHX purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PDHX protein.
Información adicional
Size 100 ug
Gene Name PDHX
Gene Alias DLDBP|E3BP|OPDX|PDX1|proX
Gene Description pyruvate dehydrogenase complex, component X
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PDHX (AAH10389.1, 1 a.a. ~ 501 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8050

Enviar uma mensagem


PDHX purified MaxPab rabbit polyclonal antibody (D01P)

PDHX purified MaxPab rabbit polyclonal antibody (D01P)