PDHX polyclonal antibody (A01)
  • PDHX polyclonal antibody (A01)

PDHX polyclonal antibody (A01)

Ref: AB-H00008050-A01
PDHX polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PDHX.
Información adicional
Size 50 uL
Gene Name PDHX
Gene Alias DLDBP|E3BP|OPDX|PDX1|proX
Gene Description pyruvate dehydrogenase complex, component X
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGRNWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDHX (NP_003468, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8050

Enviar uma mensagem


PDHX polyclonal antibody (A01)

PDHX polyclonal antibody (A01)