SLC25A16 monoclonal antibody (M01), clone 1H7
  • SLC25A16 monoclonal antibody (M01), clone 1H7

SLC25A16 monoclonal antibody (M01), clone 1H7

Ref: AB-H00008034-M01
SLC25A16 monoclonal antibody (M01), clone 1H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC25A16.
Información adicional
Size 100 ug
Gene Name SLC25A16
Gene Alias D10S105E|GDA|GDC|HGT.1|MGC39851|ML7|hML7
Gene Description solute carrier family 25 (mitochondrial carrier
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA
Immunogen Prot. Seq RVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC25A16 (NP_689920.1, 59 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8034
Clone Number 1H7
Iso type IgG2a Kappa

Enviar uma mensagem


SLC25A16 monoclonal antibody (M01), clone 1H7

SLC25A16 monoclonal antibody (M01), clone 1H7