NCOA4 monoclonal antibody (M02), clone 1A2
  • NCOA4 monoclonal antibody (M02), clone 1A2

NCOA4 monoclonal antibody (M02), clone 1A2

Ref: AB-H00008031-M02
NCOA4 monoclonal antibody (M02), clone 1A2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NCOA4.
Información adicional
Size 100 ug
Gene Name NCOA4
Gene Alias ARA70|DKFZp762E1112|ELE1|PTC3|RFG
Gene Description nuclear receptor coactivator 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NCOA4 (NP_005428, 505 a.a. ~ 614 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8031
Clone Number 1A2
Iso type IgG1 kappa

Enviar uma mensagem


NCOA4 monoclonal antibody (M02), clone 1A2

NCOA4 monoclonal antibody (M02), clone 1A2