View larger
Mouse monoclonal antibody raised against a partial recombinant MLLT10.
AB-H00008028-M02
New product
MLLT10 monoclonal antibody (M02), clone 2B9
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | MLLT10 |
| Gene Alias | AF10|DKFZp686E10210|MGC75086 |
| Gene Description | myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,ELISA |
| Immunogen Prot. Seq | QIRYDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSH |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | MLLT10 (NP_001009569, 695 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 8028 |
| Clone Number | 2B9 |
| Iso type | IgG1 Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant MLLT10.