MLLT10 monoclonal antibody (M01), clone 6H8
  • MLLT10 monoclonal antibody (M01), clone 6H8

MLLT10 monoclonal antibody (M01), clone 6H8

Ref: AB-H00008028-M01
MLLT10 monoclonal antibody (M01), clone 6H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MLLT10.
Información adicional
Size 100 ug
Gene Name MLLT10
Gene Alias AF10|DKFZp686E10210|MGC75086
Gene Description myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq QIRYDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MLLT10 (NP_001009569, 695 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8028
Clone Number 6H8
Iso type IgG1 Kappa

Enviar uma mensagem


MLLT10 monoclonal antibody (M01), clone 6H8

MLLT10 monoclonal antibody (M01), clone 6H8