STAM polyclonal antibody (A01)
  • STAM polyclonal antibody (A01)

STAM polyclonal antibody (A01)

Ref: AB-H00008027-A01
STAM polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant STAM.
Información adicional
Size 50 uL
Gene Name STAM
Gene Alias DKFZp686J2352|STAM1
Gene Description signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAM (AAH30586, 1 a.a. ~ 403 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8027

Enviar uma mensagem


STAM polyclonal antibody (A01)

STAM polyclonal antibody (A01)