LHX3 monoclonal antibody (M08), clone 2C10
  • LHX3 monoclonal antibody (M08), clone 2C10

LHX3 monoclonal antibody (M08), clone 2C10

Ref: AB-H00008022-M08
LHX3 monoclonal antibody (M08), clone 2C10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LHX3.
Información adicional
Size 100 ug
Gene Name LHX3
Gene Alias DKFZp762A2013|LIM3|M2-LHX3
Gene Description LIM homeobox 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq RWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGLAGPEQYRELRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LHX3 (NP_055379, 228 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8022
Clone Number 2C10
Iso type IgG2a Kappa

Enviar uma mensagem


LHX3 monoclonal antibody (M08), clone 2C10

LHX3 monoclonal antibody (M08), clone 2C10