PSCA monoclonal antibody (M02), clone 1E1
  • PSCA monoclonal antibody (M02), clone 1E1

PSCA monoclonal antibody (M02), clone 1E1

Ref: AB-H00008000-M02
PSCA monoclonal antibody (M02), clone 1E1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PSCA.
Información adicional
Size 100 ug
Gene Name PSCA
Gene Alias PRO232
Gene Description prostate stem cell antigen
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSCA (NP_005663, 23 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8000
Clone Number 1E1
Iso type IgG2b Kappa

Enviar uma mensagem


PSCA monoclonal antibody (M02), clone 1E1

PSCA monoclonal antibody (M02), clone 1E1