PSCA purified MaxPab rabbit polyclonal antibody (D01P)
  • PSCA purified MaxPab rabbit polyclonal antibody (D01P)

PSCA purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008000-D01P
PSCA purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PSCA protein.
Información adicional
Size 100 ug
Gene Name PSCA
Gene Alias PRO232
Gene Description prostate stem cell antigen
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKAVLLALLMAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PSCA (NP_005663.1, 1 a.a. ~ 123 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8000

Enviar uma mensagem


PSCA purified MaxPab rabbit polyclonal antibody (D01P)

PSCA purified MaxPab rabbit polyclonal antibody (D01P)