D8S2298E polyclonal antibody (A01)
  • D8S2298E polyclonal antibody (A01)

D8S2298E polyclonal antibody (A01)

Ref: AB-H00007993-A01
D8S2298E polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant D8S2298E.
Información adicional
Size 50 uL
Gene Name UBXN8
Gene Alias D8S2298E|REP8|UBXD6
Gene Description UBX domain protein 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq TCKEIPDLPEEPSQTAEEVVTVALRCPSGNVLRRRFLKSYSSQVLFDWMTRIGYHISLYSLSTSFPRRPLAVEGGQSLEDIGITVDTVLILEEKEQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen D8S2298E (NP_005662, 173 a.a. ~ 268 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7993

Enviar uma mensagem


D8S2298E polyclonal antibody (A01)

D8S2298E polyclonal antibody (A01)