ST7 purified MaxPab mouse polyclonal antibody (B01P)
  • ST7 purified MaxPab mouse polyclonal antibody (B01P)

ST7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007982-B01P
ST7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ST7 protein.
Información adicional
Size 50 ug
Gene Name ST7
Gene Alias DKFZp762O2113|ETS7q|FAM4A|FAM4A1|HELG|RAY1|SEN4|TSG7
Gene Description suppression of tumorigenicity 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAEAATGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTPKFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDSDHLRPADAIMQKAWRERNPQARISAAHEALEINECATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ST7 (AAH30954.1, 1 a.a. ~ 547 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7982

Enviar uma mensagem


ST7 purified MaxPab mouse polyclonal antibody (B01P)

ST7 purified MaxPab mouse polyclonal antibody (B01P)