MTERF monoclonal antibody (M01), clone 1A3
  • MTERF monoclonal antibody (M01), clone 1A3

MTERF monoclonal antibody (M01), clone 1A3

Ref: AB-H00007978-M01
MTERF monoclonal antibody (M01), clone 1A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MTERF.
Información adicional
Size 100 ug
Gene Name MTERF
Gene Alias MGC131634
Gene Description mitochondrial transcription termination factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MQSLSLGQTSISKGLNYLTIMAPGNLWHMRNNFLFGSRCWMTRFSAENIFKSVSFRLFGVKCHNTDSEPLKNEDLLKNLLTMGVDIDMARKRQPGVFHRM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MTERF (NP_008911, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7978
Clone Number 1A3
Iso type IgG2b Kappa

Enviar uma mensagem


MTERF monoclonal antibody (M01), clone 1A3

MTERF monoclonal antibody (M01), clone 1A3