MTERF purified MaxPab mouse polyclonal antibody (B02P)
  • MTERF purified MaxPab mouse polyclonal antibody (B02P)

MTERF purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00007978-B02P
MTERF purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MTERF protein.
Información adicional
Size 50 ug
Gene Name MTERF
Gene Alias MGC131634
Gene Description mitochondrial transcription termination factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQSLSLGQTSISKGLNYLTIMAPGNLWHMRNNFLFGSRCWMTRFSAENIFKSVSFRLFGVKCHNTDSEPLKNEDLLKNLLTMGVDIDMARKRQPGVFHRMITNEQDLKMFLLSKGASKEVIASIISRYPRAITRTPENLSKRWDLWRKIVTSDLEIVNILERSPESFFRSNNNLNLENNIKFLYSVGLTRKCLCRLLTNAPRTFSNSLDLNKQMVEFLQAAGLSLGHNDPTDFVRKIIFKNPFILIQSTKRVKAN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MTERF (ABM85067.1, 1 a.a. ~ 399 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7978

Enviar uma mensagem


MTERF purified MaxPab mouse polyclonal antibody (B02P)

MTERF purified MaxPab mouse polyclonal antibody (B02P)