FZD3 monoclonal antibody (M09), clone 2H5
  • FZD3 monoclonal antibody (M09), clone 2H5

FZD3 monoclonal antibody (M09), clone 2H5

Ref: AB-H00007976-M09
FZD3 monoclonal antibody (M09), clone 2H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FZD3.
Información adicional
Size 100 ug
Gene Name FZD3
Gene Alias Fz-3|hFz3
Gene Description frizzled homolog 3 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FZD3 (NP_059108, 55 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7976
Clone Number 2H5
Iso type IgG2a Kappa

Enviar uma mensagem


FZD3 monoclonal antibody (M09), clone 2H5

FZD3 monoclonal antibody (M09), clone 2H5