FZD3 polyclonal antibody (A01)
  • FZD3 polyclonal antibody (A01)

FZD3 polyclonal antibody (A01)

Ref: AB-H00007976-A01
FZD3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FZD3.
Información adicional
Size 50 uL
Gene Name FZD3
Gene Alias Fz-3|hFz3
Gene Description frizzled homolog 3 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FZD3 (NP_059108, 55 a.a. ~ 157 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7976

Enviar uma mensagem


FZD3 polyclonal antibody (A01)

FZD3 polyclonal antibody (A01)