JTV1 monoclonal antibody (M02), clone 8E7
  • JTV1 monoclonal antibody (M02), clone 8E7

JTV1 monoclonal antibody (M02), clone 8E7

Ref: AB-H00007965-M02
JTV1 monoclonal antibody (M02), clone 8E7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant JTV1.
Información adicional
Size 100 ug
Gene Name JTV1
Gene Alias AIMP2|P38|PRO0992
Gene Description JTV1 gene
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen JTV1 (NP_006294.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7965
Clone Number 8E7
Iso type IgG2a Kappa

Enviar uma mensagem


JTV1 monoclonal antibody (M02), clone 8E7

JTV1 monoclonal antibody (M02), clone 8E7