HSD17B8 purified MaxPab mouse polyclonal antibody (B02P)
  • HSD17B8 purified MaxPab mouse polyclonal antibody (B02P)

HSD17B8 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00007923-B02P
HSD17B8 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HSD17B8 protein.
Información adicional
Size 50 ug
Gene Name HSD17B8
Gene Alias D6S2245E|FABG|FABGL|H2-KE6|HKE6|KE6|RING2|SDR30C1|dJ1033B10.9
Gene Description hydroxysteroid (17-beta) dehydrogenase 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HSD17B8 (NP_055049.1, 1 a.a. ~ 261 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7923

Enviar uma mensagem


HSD17B8 purified MaxPab mouse polyclonal antibody (B02P)

HSD17B8 purified MaxPab mouse polyclonal antibody (B02P)